PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.8G045800.1.p
Common NamePRUPE_ppa003410mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 578aa    MW: 65600 Da    PI: 4.644
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.8G045800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.93.5e-52181442128
                 NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                         +pGfrFhPtdeelvv+yLk+k+ +k+l+l +vi+e+d+yk++P++Lp  + +k+++++w+fFs+rd+ky++g r+nrat++gyWkatgkd+
  Prupe.8G045800.1.p  18 APGFRFHPTDEELVVYYLKRKICKKRLKL-NVIAETDVYKWDPEELPglSLLKTGDRQWFFFSPRDRKYPNGGRSNRATRHGYWKATGKDR 107
                         69***************************.99***************644788899*********************************** PP

                 NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++++  ++ vglkktLv+ykgrap+ge+tdWvmhey+l
  Prupe.8G045800.1.p 108 NITC-YSRSVGLKKTLVYYKGRAPSGERTDWVMHEYTL 144
                         ****.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.84E-5812167IPR003441NAC domain
PROSITE profilePS5100554.18317167IPR003441NAC domain
PfamPF023651.6E-2719144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0070301Biological Processcellular response to hydrogen peroxide
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 578 aa     Download sequence    Send to blast
MGSEDDPEML FRNGRFCAPG FRFHPTDEEL VVYYLKRKIC KKRLKLNVIA ETDVYKWDPE  60
ELPGLSLLKT GDRQWFFFSP RDRKYPNGGR SNRATRHGYW KATGKDRNIT CYSRSVGLKK  120
TLVYYKGRAP SGERTDWVMH EYTLDEEELK RCRNVQEYYA LYKVYKKSGP GPKNGEQYGA  180
PFREEEWADD ELPVINSSAD RQIPVKQSVD VISVDPVKVN GEVHSALSDI EEFMKQIVDE  240
AVLELPQMNG YAYTIPQAVS EEETQSTVVD LYSREVVCPE PYTVFNPSDH QCNLQASFDF  300
TESDTSQIQR YEASEVTTSA PEIHEQGPPI LREEDFLEMD DLLGPEPTIS NIENPVDNLQ  360
FEGIDGLSEF DLYHDAAMFF HDMGPFDQGT VSHQQYMNSL GNNIVDQFEY QLQPNPPAVN  420
QVNHQLNPES TQMNNQLWTH TERAEPNQEF VSYSTSGVVY EPSNFASQAN QNQSGNEAAG  480
GPSQFSSALW AFVESIPTTP ASASENALVN RAFERMSSFS RLRINSVSAN VTAGSSSEAK  540
RAGRRRGFFF LPVLVALCAI FWVFMATLRP WWRCLSA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-471914417140Stress-induced transcription factor NAC1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13544KRKICKKRLK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppe.204510.0fruit
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00179DAPTransfer from AT1G34190Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007201176.10.0hypothetical protein PRUPE_ppa003410mg
SwissprotQ9XIC51e-169NAC17_ARATH; NAC domain-containing protein 17
TrEMBLM5W6F50.0M5W6F5_PRUPE; Uncharacterized protein
STRINGPOPTR_0002s06210.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61313451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.11e-156NAC domain containing protein 17